PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588722.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 299aa    MW: 33080.1 Da    PI: 8.7095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588722.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.25.1e-10754345
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                      W+ eE++ + +a++ +  +      +W++ a+t++ ++tl+q+k ++q
   XP_013588722.1  7 TWSREEEKSFENAIAIHCVEeeiteeQWSKMASTVP-TKTLEQVKKHYQ 54
                     6****************999****************.***********9 PP

2Myb_DNA-binding42.31.7e-13129173347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_013588722.1 129 PWTEEEHRLFLLGLEKFGKGDWRSISRNFVITRTPTQVASHAQKY 173
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.497361IPR017884SANT domain
SMARTSM007172.0E-4459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-5658IPR009057Homeodomain-like
PfamPF002491.6E-6754IPR001005SANT/Myb domain
CDDcd001678.94E-7757No hitNo description
SuperFamilySSF466895.96E-9864IPR009057Homeodomain-like
PROSITE profilePS5129417.271122178IPR017930Myb domain
SuperFamilySSF466892.8E-17124179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17126176IPR006447Myb domain, plants
SMARTSM007171.9E-11126176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-11127172IPR009057Homeodomain-like
CDDcd001677.08E-11129174No hitNo description
PfamPF002494.5E-12129173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MESVAVTWSR EEEKSFENAI AIHCVEEEIT EEQWSKMAST VPTKTLEQVK KHYQILLEDV  60
KAIENGQVPL PRYHRTGDEA AEASPPNRDC HSSGGSGSPE KKPNHGVSGT NGGGRSSSRH  120
EQERRKGIPW TEEEHRLFLL GLEKFGKGDW RSISRNFVIT RTPTQVASHA QKYFIRLNSM  180
NRDRRRSSIH DITSVNNQAP AVTGQQQQVA KPRPAQPQPH HPTMAGVGMY GSAPVGQPII  240
APPDHMGSAV GTPVMLPPPM GAHHHHHHHP HHLGVAPYAL PAYPVPPIPQ QHPTPSTMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-148771177RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869063e-98AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195283e-98AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248623e-98BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588722.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078IHL30.0A0A078IHL3_BRANA; BnaCnng16520D protein
TrEMBLA0A0D3CPE30.0A0A0D3CPE3_BRAOL; Uncharacterized protein
STRINGBra018772.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-124MYB family protein